top of page
Search

Smartlinks Sales Contacts

💎Official Sales Contacts:

📲+79368880706


📣Important!!! We hereby inform you that IITD, Sofline, ITIKVIK (ITQUICK), PJSC Sberbank, BOOST Technologies, NVision, as well as Anna Luneva, Dmitry Shishkin, Dmitry Mochenyat, Iosif Hamer, Sergey Mednov, Viktor Gudkov, Anatoly Dralin, Ksenia Kalemberg are not the copyright holders of forensic cybernetics product family Smartlinks, and are not authorized distributors and vendors for the supply and sale of these products. Posting information about the sale of Smartlinks products with contact details other than those given in this publication is fraudulent. In particular, mailing addresses on the smartlinks.solutions domain and telephone numbers +79163909891, +79636670139 are not numbers belonging to the copyright holders of Smartlinks products and any of the authorized vendors and distributors.

Важно!!! Настоящим информируем о том, что компании IITD, Sofline, АЙТИКВИК, ПАО Сбербанк, БУСТ Технологии, NVision, а также Анна Лунёва, Дмитрий Шишкин, Дмитрий Моченят, Иосиф Хамер, Сергей Меднов, Виктор Гудков, Анатолий Дралин, Ксения Калемберг не являются правообладателями на семейство продуктов криминалистической кибернетики Смартлинкс, и не являются уполномоченными дистрибьюторами и вендорами по поставкам и продажам данного продукта. Размещение информации о продажах продуктов Смартлинкс с указанием контактных данных, отличных от приведенных в данной публикации, является мошенничеством. В частности, почтовые адреса на домене smartlinks.solutions и телефонные номера +79163909891, +79636670139 не являются номерами принадлежащими правообладателям продуктов Смартлинкс и никому из уполномоченных вендоров и дистрибьюторов.

 
 
 

Recent Posts

See All

Comments


It's a graphic element from the website of HASHEIGHT. HASHEIGHT is a new-age techno corporation developing disruptive solutions to transform people's life. More information on www.hasheight.com hasheight,  хэшэйт, game maker, raevskaya-repnina anna maria serafima sergeevna, anna maria serafima raevskaya-repnina, раевская-репнина анна мария серафима сергеевна, анна мария серафима сергеевна раевская-репнина, раевскаярепнинааннамариясерафимасергеевна, аннамариясерафимасергеевнараевскаярепнина, annamariaserafimaraevskayarepnina, raevskayarepninaannamariaserafima, started in oxford, oxford business alumni, the university of oxford, said business school, st hughs college, oxford sbs, russia, moscow, uk, oxford, portsmouth, augmented people, eva healthcare, hiro neuronet connector, hiro, #8 plug and play business tracker, crystal ball, pink sapphire, smartlinks, boost shared services, boost business tuning atelier, ecogif, audazzle, aloniverse, problematica, prospector, selwyn lloyd
  • Pinterest
  • VK
  • Odnoklassniki
  • Blogger

SSSSSSS

bottom of page