My dear followers from outside of Russia. Please do not spend your time on this post in Russian until you want to know what the KHOLODETS word means.
KHOLODETS is one more strange dish from traditional Russian cuisine. That is the salted jelly made of meat, pork, or sometimes beef or even chicken. Below is the video with the largest KHOLODETS in the world who has attacked me, punched my face, broke my iPad, iPhone, and made many things that looked like a true KHOLODETS madness.
As long as the traditional translation will not let you an opportunity to enjoy all hidden senses utterly in their full diversity, please wait until #davnosti launched.
Follow me to enjoy the whole story about a publicly listed company (follow SSA ticket on LSE) and its employee - KHOLODETS.
KHOLODETS works for the LSE traded stock corporation. Did you know that, didn't you?
Tell me, if you suddenly were attacked by a salted pork jelly weighing a hundredweight, and began to steal your things, beat you, and smash your iPads and phones, what would you do? Where would you go first - the police or the Guinness Book of Records? I've written to the police, but they believe that salted jellied pork cannot be a criminal since anything written about the crimes of jellied meat in the RF Code of Criminal Procedure. No one will understand how to deal with this - a piece of talking pork and fat jelly weighing 100 kilos - where to send. To a pig farm or cooking. Probably have to write in the Guinness Book of Records. That is the Russian Federation, where instead of weapons for the seizure of a company that could bankrupt this very Russian Federation in aggregate, now not like with Khodorkovsky - a pre-trial detention center, Khamovnichesky court, etc. Now things are not so complicated. While Northrop Grumann is making bombers for a billion dollars, in the state of the Russian Federation, self-made entrepreneurs who have created themselves some pieces of non-ordinary intellectual property in a few years and got a good business that is attractive to the state are now being bullied by salted jellied meat.
The jellied meat will now have a slice of small jellied meat. Jellied meat is propagated by division. And the production of jellied meat is now generally almost free. No NASA needed. Just drink "beer with fish" to a living person every day and do not forget to supply menthol cigarettes. And everyone will become a jelly. So the FSB of Russia answers - 210 is not for us (*210 article of Criminal Code). That is to the Prosecutor General Office. Probably no changes have been made in 151 of the Criminal Procedure Code (*151 article of Criminal Process Code where the responsibility for investigation segregated between law enforcement agencies). 210, when organized and performed by cartoon characters with the participation of salted jellied meat, is really not the responsibility of the FSB. Even if the documents for the dual-use development have disappeared. So you have to write in the Guinness book. That with the participation of the Federal Tax Service of the Russian Federation, the FSSP (*FSSP - Federal Bailiff Service, transliterated abbreviation) of the Russian Federation, and jellied meat weighing a centner, a group of people organized the seizure of my business. Here they go nuts in the states. Both live jellied meat and a cook will gain fame, and I, as a person beaten and robbed of jellied meat. And Russian law enforcement agencies, of course. Who issued this salted pork jellied passport, driver's license, and documents for the apartment. And even earlier, the salted jellied meat was given a mortgage in the Raiffeisen Bank. It’s strange - Raiffeisen Bank stole money from my card 24500 Rubles and blocked the card. I just fixed that, honestly. He stole money - returned the stolen money - and wrote off all of them for commissions for the period when the card was blocked. Charge for premium service. They turned their ass to me and this very smart ass assays (*combination of "say" and "ass") - "you used our premium servass!"
Before that, the truth and personal records were compromised by Rife (*short, Raiffaisenbank)- he changed the address and leaked the information to someone that I was served in Rife. And he also took money from me retroactively for an unissued card that was never issued to me. That is another 6,000. And then they pretended not to know me. They gave me something at the reception in Romanov's (*VIP office of Raiffaisenbank in Moscow), and that's it. The whole Ermanno Scervino fur coat was shited all over with their Raifcrap. Raiffeisenbank's ass employees in the premium branch in the Romanov courtyard gave me this (by the way, this is my inherited territory - that called Repnin Yard, I am thinking of first of all to deal with this real estate object. - in Repnin's Yard there should not be oversized dirty public restrooms, in which shit has not been cleaned for 12 years, so it stinks right up to the Kremlin), as we have it, for people who are not bank customers, we simply charge a left (*in Russia "left" is used to notice something wrong, fake, falsified, bad) commission for issuing a card. We are a big bank so sooner, or later you would have come to us anyway - but here we are waiting for you, with our left commission that we screwed you 12 years ago. Just like in the joke about the cucumber.
A man comes to the dance and to the buffet: "Please, one hundred grams and a cucumber!"
He drinks vodka, puts the cucumber in his pocket. The barmaid is perplexed: "Why not
have a snack? ". Man:" Its own strategy. I put a cucumber in my right pocket
I invite the lady to dance and immediately press her to her right side ... She thinks
that it is %%%, rushes to the left, and here we were waiting for it !!! ".
But the salted jellied meat was even given a mortgage! In the Rife! And I wonder why humans can't be served in the Rife. I mean myself. Komsomol athlete without problems with weight and appearance. An entrepreneur who made a fortune with his brains. Oxford graduate, Harvard, Stanford, and MIT student. Certified lawyer and economist. Without bad habits. Oh, that's why. Because the targeted client of Raiffeisenbank's is KHOLODETS. Salted jellied pork. Aspic, by the way, considers herself a "normal human." Fatty aspic ("normal human") is dancing striptease, you know? Probably on a pole with extra strength. The secret to the weight of jellied meat is a special diet. Eight liters of beer at night - and not even a single wrinkle. And a couple of marijuana joints. And she believes that all normal people have turned their backs on me. Thank God, all the jellied meat - "normal humans" - fell off. God took away. And stories about what other businesses are for jellied meat, and according to what articles in the Criminal Code of the Russian Federation, jellied meat is not yet planted and judged, and who protects talking pork aspic - on the davnosti website. I don't want to post this crap in my business and life feed.
This is such mini-project, well-outdated news. When in 2008 the Federal Tax Service squeezed Eldorado from Yakovlev, and the jellied meat girlfriends (I swear, the salted pork aspic that attacked me is just a sucker in comparison with her mega-girlfriends - "the grand@ in full senses Kashina was interviewed for the chief accountant in the Children's World, I generally begin to feel like angry birds lately) they wore SALT on 01 accounts with red residues (*negative balance of the fixed assets account which is impossible if the accounting made correct) at the Federal Tax Service - Kashina gave me such paperbacks and complained very much about me that I was sending it to the dick in a rude form for such pieces of paper that she offered to give me to the Federal Tax Service Inspectorate No. 28 when the next field check of Eldorado was going on (*the most difficult, aggressive and complicated tax audit). She doesn't give a fuck - let Seregin go to jail, Yakovlev as well, and let him Kashina sit out on his salary and dump. Of course, this jellied pork meat was brutally displeased with me, and I think that she, too, would have piled on me for my essentially stupid claims - I demanded a positive balance on account 01 (*fixed assets account, where the negative balance is impossible). And in general, she demanded not to substitute Yakovlev. And the jellied meat had other tasks - ZARPLATOCHKA (*salary) and CHAYOK (*tea). And the second jellied meat has BEER WITH FISH. For those who uninitiated in accounting or those who know it as both aspics, I inform you that 01 account is active for accounting of fixed assets. There can be no remainder of "minus one hundred machines" on it. Because this account is 01, this is not a black hole but the accounting of real property. And there can be no red residue. Because the inventory must be done on time and everything that has been copied should be reflected in the accounting if this has happened. And if they did not steal anything, and the remainder is red, then the accounting is carried out by the jellied meat. Who has meat jelly in the ass and in the brain. The ass and the brain are of the same kind - salted pork aspic.
In general, accounting, as you understand, is just a primordially cold-blooded profession - do not submit reports on time, bring balance sheets with red balances on active accounts to the Federal Tax Service for an on-site inspection, and also sell in Auchan goods that have not been registered yet in the accounting - this is just craftsmanship and creative accounting powered by aspic. In general, I think to register a special TM for salted pork aspic and give it to a native of the city of Bugurslan from the Orenburg region, located in close proximity to Ufa and the Bashneft company, which has become a slice of jellied meat. She also needs a beautiful brand to put on a shared service center for filling up the accounting, wiping out deadlines for submitting reports, and creative accounting with red inventory leftovers).
I give the KHOLODETS SHARIT SERVICE (*sharit is the change of the SHARED. In the Russian context, "sharit" means poking in my belongings). You don't even need to steal it from me and SHARE it according to my documents. Just take it and get it on yourself. So I got distracted - then in the Eldorado (*hostile takeover of the company in 2008) of Communications, it was number 1 in our action plan to save the company. So wellcome are #davnosti. Well outdated news. In general, these are only facts from the past, without any assessments. Let the readers put grades. Well, for example - bailiff Kalischuk Yu.E. She changed the data of a non-existent debtor in the FSSP electronic database 20 times in order to fit them into mine, to steal my car for 15 million, then, after leaving me without a car, to rewrite the share in my company LLC UK BOOST to MI FTS No.46 and stole my documents confirming my title for shares in the company, to understand - what was stolen from me and how correctly, "beautifully," to take into account the stake, stolen from me. I am sure that they even approved that at the CFI (*KFI, the Finance and Investments Committee at AFK Sistema) in a narrow circle. Jellied meat, the chef of jellied meat, and petrovich (*V.P.Evtushenkov). In short, all these marvelous stories - why the jellied meat suddenly began waving its jelly hands, croaking with its painted lips something about "tebe pokazalos" (*"everything seems to you") - everything is now on the #davnosti portal. Especially for the chefs of Jelly Pork - I don't need any permits or licenses for this. That's a fucking blog, and I don't fucking need other people's posts and ads on my sites. Contact the place where pornography is distributed, they like to make money on advertising. This is for your former protégé - Kozlov Igor Ilyich, a lover of strange investment projects. There is a whole "big dick" leader now in NPO SVETLANA. Goslavka (*state-owned company), which works for the defense industry. Here, too, gentlemen under the tsar, you have problems with personnel. You hired a dude, who, after logging out of the system, was able to look for investors in an investment project for accepting payments on porn sites and then, apparently out of despair, still flooded with roselectronics, which the zverev could not even do so clearly.
#davnosti are needed to do not spoil my beautiful site about my unicorn terrarium with your fat-swollen aspic and pork head. And with ugly stories about how the smart business in our state is squeezed out and trying to constantly kill the business owner, and at the same time cry that we do not have entrepreneurship. And so that we can write off the budget money under the cut. The business does not need your support, just stop taking away and divide, and nightmare the business. Supporting entrepreneurship is not about how to infuse the budget into projects. It is about how to stop killing people who are still in this country, and do something else with their hands and brains, and succeeded with that. Fuck off from entrepreneurs along with your old asshole with a surname that starts with a T. There is no need to defend the rights of entrepreneurs. Neither I nor my companies need a funeral at public expense. There is no need to write off billions on the automation of processes in the Federal Tax Service, Pension Fund of Russia, and FSS, which remained manual at the Mesozoic level and administered by the same jellied pork meat. Keep your fucking budget handouts for yourself. Better to spend on normal people. To hire them. Those who will understand what is going on with business and how to establish public administration processes. Otherwise, you will hire thieving drug addicts who sit tightly on coconut (*slang, cocaine) on the boards of directors in defense companies. In general, it is customary to isolate the sewer riser in a separate place. Read Anatolyevich Maratovich and Petrovich about your jellied pork aspic (this is what you hire to make your jellied meat earning money for you - look at the jellied meat cattle and its broken-down Qashqai with the broken steering wheel and wheels, and on the jellied meat clothes for three hundred rubles, especially slippers inserted me jellied meat - such a slice of jellied meat at the moment represents your company, the whole consortium, the face of the consortium is now KHOLODETS).
In short, read your [reading] separately, in the toilet. Out of habit, so to speak, for sufferers of constipation with a library over the toilet. There's a mastercard for everything else.
#afksistema #sistemahiring #raevskayarepnina #boostyoursuperiority #boost #asyaramazanova #ramazanovasegezha #рамазановаасиякуанышевна
#гиннесскрупнейшийвмирехолодец #холодецатакует #davnosti #parahyaenabrunneaasya #kholodetsattacks #бураягиенаася #атакахолодцом #raevskayarepnina #annamariaserafimaraevskayarepnina #раевскаярепнина #аннамариясерафимараевскаярепнина #meggi #skjold #meggifromskjold #meggifromhouseofskjold #raevskayarepninaafksistema #раевскаярепнинаафксистема #boostvsafksistema #boostvsalfagroup #boostvsanguard #bigleague #3rdreich #nordost #romanovs
Comments